Mouse Anti-Zebrafish tnc Antibody (CBMOAB-10146FYB)


Cat: CBMOAB-10146FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO10146FYB
SpecificityThis antibody binds to Zebrafish tnc.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration.
Product OverviewMouse Anti-Zebrafish tnc Antibody is a mouse antibody against tnc. It can be used for tnc detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestnc; TNC Gene(Protein Coding) Tenascin C
UniProt IDF1QYE2
Protein RefseqThe length of the protein is 1811 amino acids long.
The sequence is show below: MGMRGLLLASMAVAVLVHLSSAGLVKRVIRHRRESLSPTTENLTLPSPDQPVVFNHVYNINVPSGSLCSVDMDSPGTTEIKPKSEQSDQHIEHTTDGENQIVFTHRINIPKQACGCDNHMPDMKELLNRLEMLEAEVSSLREQCTSGAGCCSAQVTGEVTTKPYCSGRGNYSTDTCSC.
For Research Use Only | Not For Clinical Use.
Online Inquiry