AibGenesis™ Mouse Anti-tomm5 Antibody (CBMOAB-10356FYB)
Cat: CBMOAB-10356FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-10356FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO10356FYB | 100 µg | ||
| MO-AB-06656W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO06656W | 100 µg | ||
| MO-AB-19409W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19409W | 100 µg | ||
| MO-AB-22035R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22035R | 100 µg | ||
| MO-AB-29689H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29689C | 100 µg | ||
| MO-AB-66686W | Monoclonal | Marmoset | WB, ELISA | MO66686W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO10356FYB |
| Specificity | This antibody binds to Zebrafish tomm5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Zebrafish tomm5 Antibody is a mouse antibody against tomm5. It can be used for tomm5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Novel protein; tomm5; OTTDARP00000001946 si:ch211-240l14. |
| UniProt ID | Q7SZY9 |
| Protein Refseq | The length of the protein is 74 amino acids long. The sequence is show below: MDPEEMKKKMREDVITSVRNFLIYVALLRVKAGQHMKLHPWAKTFPVQKSMRDWDDAAQNRLHRQSTKRCGQFV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry