AibGenesis™ Mouse Anti-tpst2 Antibody (CBMOAB-10546FYB)


Cat: CBMOAB-10546FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10546FYB Monoclonal Zebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO10546FYB 100 µg
CBMOAB-12283HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO12283HB 100 µg
MO-AB-04562Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04562Y 100 µg
MO-AB-08670H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08670C 100 µg
MO-AB-22091R Monoclonal Cattle (Bos taurus) WB, ELISA MO22091R 100 µg
MO-AB-22747W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22747W 100 µg
MO-AB-66786W Monoclonal Marmoset WB, ELISA MO66786W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO10546FYB
SpecificityThis antibody binds to Zebrafish tpst2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Two transcript variants encoding the same protein have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish tpst2 Antibody is a mouse antibody against tpst2. It can be used for tpst2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:64196; tpst2; zgc:6419
UniProt IDQ7T295
Protein RefseqThe length of the protein is 356 amino acids long.
The sequence is show below: MRLSIKRTLFLLFTLFGGYTLIRTLYRVIACHGKLTGAHVVSVLVQNRTRYRYDRNTPIVFVGGVPRSGTTLMRAMLDAHPLIRCGAETRVIPRVLSLRQAGTEQPGVDQEILDAATTAFLLEVIARHGEPAPMLCNKDPFTLKSAVYLSHLFPNSKFVLMLRDGRASVHSMISRRVTIAGFDLSSYRDCLTKWSSAIQAMLSQCMAVGSRRCLTVRYEDLVLRPRTSMQRVLLFLQSPWHEGVLHHEEAIGQPGGVSLSRTERSTDQVIKPVNLEALTRWVGHIPADVQDDLENIAPMLRRLGYNPNANPPDYGQPDPEVINNTQRVLKGDFKIPRSLKKWAQESPIIGSKGGRK.
For Research Use Only | Not For Clinical Use.
Online Inquiry