AibGenesis™ Mouse Anti-ufc1 Antibody (CBMOAB-11661FYB)
Cat: CBMOAB-11661FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-11661FYB | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO11661FYB | 100 µg | ||
| MO-AB-01593L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01593L | 100 µg | ||
| MO-AB-03262W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO03262W | 100 µg | ||
| MO-AB-07843W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07843W | 100 µg | ||
| MO-AB-10388Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10388Y | 100 µg | ||
| MO-AB-11352W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11352W | 100 µg | ||
| MO-AB-18136Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO18136Y | 100 µg | ||
| MO-AB-22566R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22566R | 100 µg | ||
| MO-AB-29915H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29915C | 100 µg | ||
| MO-AB-31110R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO31110R | 100 µg | ||
| MO-AB-33926W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33926W | 100 µg | ||
| MO-AB-35924W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35924W | 100 µg | ||
| MO-AB-42791W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42791W | 100 µg | ||
| MO-AB-46991W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46991W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO11661FYB |
| Specificity | This antibody binds to Zebrafish ufc1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | E2-like enzyme which specifically catalyzes the second step in ufmylation. Accepts the ubiquitin-like modifier UFM1 from the E1 enzyme UBA5 and forms an intermediate with UFM1 via a thioester linkage. Ufmylation is involved in various processes, such as ribosome recycling, response to DNA damage, interferon response or reticulophagy (also called ER-phagy). (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Zebrafish ufc1 Antibody is a mouse antibody against ufc1. It can be used for ufc1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Ubiquitin-fold modifier-conjugating enzyme 1; Ufm1-conjugating enzyme 1; ufc |
| UniProt ID | Q6DEN0 |
| Protein Refseq | The length of the protein is 166 amino acids long. The sequence is show below: MADEATRKAVSEIPLLKTNSGPRDKELWVQRLREEYLALIKYVENNKAADNDWFRLESNKEGTRWFGKCWYIHELLKYEFDMEFDIPVTYPATAPEVAIPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIAKGLIQHKDQNS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry