AibGenesis™ Mouse Anti-ufc1 Antibody (CBMOAB-11661FYB)


Cat: CBMOAB-11661FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11661FYB Monoclonal Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO11661FYB 100 µg
MO-AB-01593L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01593L 100 µg
MO-AB-03262W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO03262W 100 µg
MO-AB-07843W Monoclonal Cat (Felis catus) WB, ELISA MO07843W 100 µg
MO-AB-10388Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10388Y 100 µg
MO-AB-11352W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11352W 100 µg
MO-AB-18136Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18136Y 100 µg
MO-AB-22566R Monoclonal Cattle (Bos taurus) WB, ELISA MO22566R 100 µg
MO-AB-29915H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29915C 100 µg
MO-AB-31110R Monoclonal Pig (Sus scrofa) WB, ELISA MO31110R 100 µg
MO-AB-33926W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33926W 100 µg
MO-AB-35924W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35924W 100 µg
MO-AB-42791W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42791W 100 µg
MO-AB-46991W Monoclonal Horse (Equus caballus) WB, ELISA MO46991W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO11661FYB
SpecificityThis antibody binds to Zebrafish ufc1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionE2-like enzyme which specifically catalyzes the second step in ufmylation. Accepts the ubiquitin-like modifier UFM1 from the E1 enzyme UBA5 and forms an intermediate with UFM1 via a thioester linkage. Ufmylation is involved in various processes, such as ribosome recycling, response to DNA damage, interferon response or reticulophagy (also called ER-phagy). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish ufc1 Antibody is a mouse antibody against ufc1. It can be used for ufc1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUbiquitin-fold modifier-conjugating enzyme 1; Ufm1-conjugating enzyme 1; ufc
UniProt IDQ6DEN0
Protein RefseqThe length of the protein is 166 amino acids long.
The sequence is show below: MADEATRKAVSEIPLLKTNSGPRDKELWVQRLREEYLALIKYVENNKAADNDWFRLESNKEGTRWFGKCWYIHELLKYEFDMEFDIPVTYPATAPEVAIPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIAKGLIQHKDQNS.
For Research Use Only | Not For Clinical Use.
Online Inquiry