AibGenesis™ Mouse Anti-vdrb Antibody (CBMOAB-15756FYB)


Cat: CBMOAB-15756FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-15756FYB Monoclonal Zebrafish (Danio rerio), Medaka (Oryzias latipes) WB, ELISA MO15756FYB 100 µg
MO-AB-01900R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01900R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Medaka (Oryzias latipes)
CloneMO15756FYB
SpecificityThis antibody binds to Zebrafish vdrb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish vdrb Antibody is a mouse antibody against vdrb. It can be used for vdrb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVitamin D3 receptor B; VDR-B; 1,25-dihydroxyvitamin D3 receptor B; Nuclear receptor subfamily 1 group I member 1-B; vdrb; nr1i1b; NP_001153457.
UniProt IDQ1L673
Protein RefseqThe length of the protein is 422 amino acids long.
The sequence is show below: MESAVSTSTQVPDEFDRNVPRICGVCGDKATGFHFNAMTCEGCKGFFRRSMKRKASFTCPFNGSCTITKDNRRHCQACRLKRCLDIGMMKEFILTDEEVQRKKELIQRRKDEEAHREAQKPRLSDEQRNIIDTLVDAHHKTYDDSYSDFSRFRPPVREGPVTRSASRAASLHSLSDASSDSFSHSPESGDRKMNLSNLLMMYQEQGLSSSPDSKEEDGSSLSMLPHLADLVSYSIQKVIGFAKMIPGFRELTAEDQIALLKSSAIEVIMLRSNQSFSLEDMSWSCGGPEFKYCVNDVTKAGHTLELLEPLVKFQVGLKKLNLHEEEHVLLMAICLLSPDRPGVQDHVRVEALQDKVSEVLQAYIRAHHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGGQVT.
For Research Use Only | Not For Clinical Use.
Online Inquiry