AibGenesis™ Mouse Anti-vwde Antibody (CBMOAB-16025FYB)


Cat: CBMOAB-16025FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16025FYB Monoclonal Zebrafish (Danio rerio), Rhesus (Macaca mulatta) WB, ELISA MO16025FYB 100 µg
MO-AB-06894W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06894W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rhesus (Macaca mulatta)
CloneMO16025FYB
SpecificityThis antibody binds to Zebrafish vwde.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish vwde Antibody is a mouse antibody against vwde. It can be used for vwde detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesvwde; Von Willebrand Factor D And EGF Domains
UniProt IDF1Q701
Protein RefseqThe length of the protein is 212 amino acids long.
The sequence is show below: MKMAGLCCMSMQLLLLALAALVGISLGGSDGPRGVALPFVFDPKATCDPPCKHAGICIRNNTCFCSRGYEGETCQFANCYPKCKNGGECLRPGKCRCPSGFGGKFCHRVVCDAGCWNGGECTAVNGEAKCICPSSWTGSRCQDAICPQGCKNGGICVAPGICSCPDGWIGGACHTAVCKKPCVNGGKCVSPNTCRCRGLFTGPQCEERKKLY.
For Research Use Only | Not For Clinical Use.
Online Inquiry