Mouse Anti-Zebrafish wnt3a Antibody (CBMOAB-16316FYB)


Cat: CBMOAB-16316FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO16316FYB
SpecificityThis antibody binds to Zebrafish wnt3a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 96% amino acid identity to mouse Wnt3A protein, and 84% to human WNT3 protein, another WNT gene product. This gene is clustered with WNT14 gene, another family member, in chromosome 1q42 region.
Product OverviewMouse Anti-Zebrafish wnt3a Antibody is a mouse antibody against wnt3a. It can be used for wnt3a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Wnt; wnt3a; wnt3 l wnt3
UniProt IDQ6IYD9
Protein RefseqThe length of the protein is 365 amino acids long.
The sequence is show below: MIYLGYFLFLFCGLTRVMASYPIWWSLAVGHQYTSLGTQPIMCSSIPGLVPKQLRFCRNYVEIMPSVAEGVKIGIQECQHQFRGRRWNCTTINDKLAIFGPVLDKEKERKIGFKQAKATRESAFVHAIASAGVAFXVTRACTEGSATICGCDSRRKGPPGEGWKWGGCSEDVEFGSMVSREFADARENRPDARSAMNRHNNEAGRSSITDHMYLKCKCHGLSGSCEVKTCWWSQPDFRVIGDYMKDKYDSASEMVVEKHRESRGWVETLRPKYPYYKPPTETDLVYYESSPNFCEPNPETGSFGTRDRTCNLTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECTRVYDVHTCK.
For Research Use Only | Not For Clinical Use.
Online Inquiry