AibGenesis™ Mouse Anti-ypel1 Antibody (CBMOAB-16583FYB)


Cat: CBMOAB-16583FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16583FYB Monoclonal Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO16583FYB 100 µg
MO-AB-01711L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01711L 100 µg
MO-AB-09305W Monoclonal Cat (Felis catus) WB, ELISA MO09305W 100 µg
MO-AB-09413H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09413C 100 µg
MO-AB-10531Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10531Y 100 µg
MO-AB-18291Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18291Y 100 µg
MO-AB-23065R Monoclonal Cattle (Bos taurus) WB, ELISA MO23065R 100 µg
MO-AB-26100W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26100W 100 µg
MO-AB-30071H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30071C 100 µg
MO-AB-34052H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO34052C 100 µg
MO-AB-36010W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO36010W 100 µg
MO-AB-47108W Monoclonal Horse (Equus caballus) WB, ELISA MO47108W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO16583FYB
SpecificityThis antibody binds to Zebrafish ypel1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ypel1 Antibody is a mouse antibody against ypel1. It can be used for ypel1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein yippee-like; ypel1; NP_001003780.1;XP_005165102.
UniProt IDQ6AXK6
Protein RefseqThe length of the protein is 119 amino acids long.
The sequence is show below: MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE.
For Research Use Only | Not For Clinical Use.
Online Inquiry