AibGenesis™ Mouse Anti-zcchc17 Antibody (CBMOAB-16748FYB)


Cat: CBMOAB-16748FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16748FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO16748FYB 100 µg
MO-AB-04848Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04848Y 100 µg
MO-AB-21113W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21113W 100 µg
MO-AB-23141R Monoclonal Cattle (Bos taurus) WB, ELISA MO23141R 100 µg
MO-AB-30089H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30089C 100 µg
MO-AB-68161W Monoclonal Marmoset WB, ELISA MO68161W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO16748FYB
SpecificityThis antibody binds to Zebrafish zcchc17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish zcchc17 Antibody is a mouse antibody against zcchc17. It can be used for zcchc17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger, CCHC domain containing 17; zcchc1
UniProt IDQ7SZN1
Protein RefseqThe length of the protein is 235 amino acids long.
The sequence is show below: MAEEHMREPVGLDGLPPMYSILKGEVVSVTAYGAFVKIPGYRKQGLVHKSEMSACRVENPAEIVDVGEQVWIKVIGKEMKDDKVKLSFSMNSVNQGTGRDLDPNNVIAEQDERRRRQFRDHSGQRITLEAVLNTTCKKCGCRGHFAKDCFSSPGLQYSLLPEEEEEEPPSTQITQSEPQKRKKEKKAKKEKKKKKDRKRENSTSDSSNEDAKRPKHSHTHSEKKKKHKKHKHKSK.
For Research Use Only | Not For Clinical Use.
Online Inquiry