AibGenesis™ Mouse Anti-zfyve21 Antibody (CBMOAB-16903FYB)


Cat: CBMOAB-16903FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16903FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO16903FYB 100 µg
MO-AB-07056W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07056W 100 µg
MO-AB-09489H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09489C 100 µg
MO-AB-23210R Monoclonal Cattle (Bos taurus) WB, ELISA MO23210R 100 µg
MO-AB-24641W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24641W 100 µg
MO-AB-30118H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30118C 100 µg
MO-AB-68267W Monoclonal Marmoset WB, ELISA MO68267W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO16903FYB
SpecificityThis antibody binds to Zebrafish zfyve21.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish zfyve21 Antibody is a mouse antibody against zfyve21. It can be used for zfyve21 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZfyve21 protein; zfyve2
UniProt IDQ1JQ51
Protein RefseqThe length of the protein is 252 amino acids long.
The sequence is show below: VRAAGRAADVCSVLLSSSSCALINTNMSAVPDGKKLVRSPSGLRMVPENGAFNSPFTLDEPQWVPDKECPRCMQCDTKFDFITRKHHCRRCGRCFCDKCCSQKVALPRMCFVDPVRQCAECSLISQKEVEFYDKQLKVLTAGGTFVVKVGSSEKSETMVCRLSNNHRYLFLDGNSHFEVELSRISSMQVLTEGSTPGGGTLRASGMVLQYKPPGSLDLQQLNMDTADDKRIASAWLAAMHKAAKLLYESKDQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry