Mouse Anti-ZNF180 Antibody (CBMOAB-62988FYA)


Cat: CBMOAB-62988FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62988FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO62988FYA 100 µg
MO-AB-23242R Monoclonal Cattle (Bos taurus) WB, ELISA MO23242R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO62988FYA
SpecificityThis antibody binds to Rhesus ZNF180.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionZNF180 (Zinc finger protein 180) is a member of the C2H2-type zinc finger protein family, characterized by multiple tandem zinc finger domains. It is hypothesized to play a role in gene transcriptional regulation through binding to specific DNA or RNA sequences.
Product OverviewMouse Anti-Rhesus ZNF180 Antibody is a mouse antibody against ZNF180. It can be used for ZNF180 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 180; ZNF180
UniProt IDH9FE64
Protein RefseqThe length of the protein is 460 amino acids long.
The sequence is show below: ESMAEQDEKPPEPPKACAQDSFLPQEIIIKVEGEDTGSLTIPSQEGVNFKIVTVDFTQEEQGTWNPAQRTLDRDVILENHRDLVSWDLTTAVGKKDPTSKQSIFDEEPANGVKIERLTRDDPWLSSCEEVGDYKDQLEKQQEKQEILLQEVAFTQRNAVIHERVCKSDEPGEKSGLNSSLFSSPIISIRNHFHKHVSHAKKWHLNSAVNSHQKINENETLYENNECGKPPQSIHLIQFTRTQTKDKSYGFSDSIQSFCHGTPLHIHEKIHGGGKTFDFKECGQVLNPNISHNEQQRIPFEESQYKCSKTSQSSSVTQSMRNNSEEKPFECNQCGKSFSWSSHLVAHQRTHTGEKPYECSECGKSFGRSSHLVSHQRTHTGEKPYRCNQCGKSFSQSYVLVVHQRTHTGEKPYECNQCGKSFRQSYKLIAHQRTHTGEKPYECNQCGKSFIQSYKLIAHQR.
For Research Use Only | Not For Clinical Use.
Online Inquiry