AibGenesis™ Mouse Anti-ZNF19 Antibody (CBMOAB-62993FYA)


Cat: CBMOAB-62993FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62993FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO62993FYA 100 µg
MO-AB-23249R Monoclonal Cattle (Bos taurus) WB, ELISA MO23249R 100 µg
MO-AB-68355W Monoclonal Marmoset WB, ELISA MO68355W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO62993FYA
SpecificityThis antibody binds to Rhesus ZNF19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains a zinc finger, a nucleic acid-binding domain present in many transcription factors. This gene is located in a region next to ZNF23, a gene also encoding a zinc finger protein, on chromosome 16. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF19 Antibody is a mouse antibody against ZNF19. It can be used for ZNF19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 19; ZNF19
UniProt IDH9EZ81
Protein RefseqThe length of the protein is 272 amino acids long.
The sequence is show below: MAAIPLKTRHQEMVTFEDVAVHFTKTEWTGLSPAQRALYRSVMLENFGNLTALGYPVPKPALISLLEGGDMAWGLEAQDDPPAERTKNICKDVETNIDSESTLIQGISEERDGMMSRGQLKSVPQRTDFPETCNVKKHQNIPTVKNTRGKVPRIPCARKPFICEECGKSFSYFSYYARHQRIHTGEKPFECSECGKAFNGNSSLIRHQRIHTGEKPYQCEECGRAFNDNANLIRHQRIHSGDRPYYCTECGNSFTSSSEFVIHQRIHTGEKP.
For Research Use Only | Not For Clinical Use.
Online Inquiry