AibGenesis™ Mouse Anti-ZNF420 Antibody (CBMOAB-63229FYA)


Cat: CBMOAB-63229FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63229FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis) WB, ELISA MO63229FYA 100 µg
MO-AB-09526H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09526C 100 µg
MO-AB-23301R Monoclonal Cattle (Bos taurus) WB, ELISA MO23301R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis)
CloneMO63229FYA
SpecificityThis antibody binds to Rhesus ZNF420.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a KRAB-type zinc finger protein that negatively-regulates p53-mediated apoptosis. Under stress conditions, the encoded protein is phosphorylated by ATM and dissociates from p53, which activates p53 and initiates apoptosis. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF420 Antibody is a mouse antibody against ZNF420. It can be used for ZNF420 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 420; ZNF420
UniProt IDH9FE21
Protein RefseqThe length of the protein is 117 amino acids long.
The sequence is show below: CKECGKAFSCGSDLTRHQRIHTGEKPYKCEECGKAFIRGSQLTQHQRIHTNEKPYECKECGKMFSHGSQLTQHQRIHTGEKPYQCKECGKAFNRGSLLTRHQRIHTGEKPYECKECR.
For Research Use Only | Not For Clinical Use.
Online Inquiry