AibGenesis™ Mouse Anti-ZNF502 Antibody (CBMOAB-63312FYA)


Cat: CBMOAB-63312FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63312FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO63312FYA 100 µg
MO-AB-23317R Monoclonal Cattle (Bos taurus) WB, ELISA MO23317R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO63312FYA
SpecificityThis antibody binds to Rhesus ZNF502.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF502 Antibody is a mouse antibody against ZNF502. It can be used for ZNF502 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 502; ZNF502
UniProt IDH9EYE0
Protein RefseqThe length of the protein is 241 amino acids long.
The sequence is show below: MLNMQGTEEREIRRETCPGWVNKNKPAPEQDVCKTDSSGIVAKRFQEDEYQDSTFEEKYACEGMKENSPREIAESCLFQEGGFGGITFIHKEAPPEIISQNYNFEKSLLLTSSLVTRLRVSTEESLHQWETSNVHTNDFSDHSKCPTLCTQKKSWKCNECGKTFTQGSSLTQHQRTHTGERPYACEECGKAFSRSSFLVQHQRIHTGVKPYGCEQCGKTFRCRSFLTQHQRVHTGEKPYKC.
For Research Use Only | Not For Clinical Use.
Online Inquiry