AibGenesis™ Mouse Anti-ZNF655 Antibody (MO-AB-07230W)


Cat: MO-AB-07230W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07230W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO07230W 100 µg
MO-AB-15844W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15844W 100 µg
MO-AB-23350R Monoclonal Cattle (Bos taurus) WB, ELISA MO23350R 100 µg
MO-AB-68582W Monoclonal Marmoset WB, ELISA MO68582W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO07230W
SpecificityThis antibody binds to Rhesus ZNF655.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a zinc finger protein. The zinc finger proteins are involved in DNA binding and protein-protein interactions. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF655 Antibody is a mouse antibody against ZNF655. It can be used for ZNF655 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 655 isoform b; ZNF655
UniProt IDH9FC47
Protein RefseqThe length of the protein is 111 amino acids long.
The sequence is show below: ARYQEFVTFEDVAVHLTREEWGYLDPVQRDLYREVMLENYGNVVSLGILLRLPTTRIHSVNSCPALSHTQASAFSGETLAILTAGISKRWPKYRLPIDIARPCSETPFPRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry