AibGenesis™ Mouse Anti-ZNF673 Antibody (MO-AB-07234W)


Cat: MO-AB-07234W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07234W Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO07234W 100 µg
MO-AB-12806W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12806W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO07234W
SpecificityThis antibody binds to Rhesus ZNF673.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF673 Antibody is a mouse antibody against ZNF673. It can be used for ZNF673 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein ZNF673 isoform 1; ZNF673
UniProt IDH9YY62
Protein RefseqThe length of the protein is 155 amino acids long.
The sequence is show below: MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGYLVAKPDVIFRLGPGEESWMADGGTPVRTCAGEDRPEVWQVDEQIDCYKESQDKLLWQAAFIGKETLKDESGQESRTCRKSIYLSTEFDSVRQRLPKYYSWEKAFKT.
For Research Use Only | Not For Clinical Use.
Online Inquiry