Mouse Anti-ZNF75D Antibody (CBMOAB-63579FYA)


Cat: CBMOAB-63579FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63579FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO63579FYA 100 µg
MO-AB-07252W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07252W 100 µg
MO-AB-25485W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25485W 100 µg
MO-AB-68608W Monoclonal Marmoset WB, ELISA MO68608W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO63579FYA
SpecificityThis antibody binds to Rhesus ZNF75D.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that likely functions as a transcription factor. The protein, which belongs to the ZNF75 family, includes an N-terminal SCAN domain, a KRAB box, and five C2H2-type zinc finger motifs. Another functional gene belonging to this family is located on chromosome 16, while pseudogenes have been identified on chromosomes 11 and 12. Alternative splicing results in multiple transcripts variants. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF75D Antibody is a mouse antibody against ZNF75D. It can be used for ZNF75D detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF75D
UniProt IDF6TZ55
Protein RefseqThe length of the protein is 415 amino acids long.
The sequence is show below: MTMRELKADSCSNPQMGAMWETSGSVNENFSQSKKYSANIESLGPESACRHFWSFRYHEATGPLETISQLQKLCHQWLRPEIHSKEQILEMLVLEQFLSILPKETQNWVQKHHPQNVKQALVLVEFLQREPDGTKNESLLTFEDVAVYFSEEEWQLLDPPEKTLYNDVMQDIYETVISLGLKLKNDTGNDHPISVSTSEIQTSGCKVSKKTRMKIAQKTMGRENPGDTHSVQKWHRAFPRKKRKKLATCKQEVPKLMDLHGKGPTGEKPFKCQECGKSFRVSSDLIKHQRIHTGEKPYKCQQCDKRFRWSSDLNKHFMTHQGIKPYRCSWCGKSFSHNTNLHTHQRIHTGEKPFKCDECGKRFIQNSHLIKHQRTHTGEQPYTCSICKRNFSRRSSLLRHQKLHRRREACLLSSD.
For Research Use Only | Not For Clinical Use.
Online Inquiry