Mouse Anti-ZNF775 Antibody (CBMOAB-63596FYA)


Cat: CBMOAB-63596FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63596FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO63596FYA 100 µg
MO-AB-23370R Monoclonal Cattle (Bos taurus) WB, ELISA MO23370R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO63596FYA
SpecificityThis antibody binds to Rhesus ZNF775.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZNF775 Antibody is a mouse antibody against ZNF775. It can be used for ZNF775 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZNF775
UniProt IDF7FRF4
Protein RefseqThe length of the protein is 332 amino acids long.
The sequence is show below: GAGLVMKVKQEKPERLLQILAPQVMLAEKDKENIFQQHPGLPPCQIMGRPRALGGQEESGSPRWAPPTEHDAGLAGRAPGSASGPLSPSLSAEGHFVCLDCGKRFSWWSSLKIHQRTHTGEKPYLCGNCGRRFSQKPNLTRHLRNHTGERPHPCPHCGRGFRQKQHLLKHLRTHLPGAQAAPCPSCGKSCRSRAALRAHQRAHAAAEPAVPAGEPGRGHPRLGRAAAELPTVPRGPGRAVGPGTRGPHRAWRAAPVHLQRVRQELLVVVGAHHPPAHPHWRAALPVPRVRPPLQPEAQSDAAPAQPHRRAALPVSRLRPRLQPEAASAQAPA.
For Research Use Only | Not For Clinical Use.
Online Inquiry