AibGenesis™ Mouse Anti-ZNF879 Antibody (CBMOAB-63661FYA)


Cat: CBMOAB-63661FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63661FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO63661FYA 100 µg
MO-AB-07276W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07276W 100 µg
MO-AB-14247W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14247W 100 µg
MO-AB-68649W Monoclonal Marmoset WB, ELISA MO68649W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO63661FYA
SpecificityThis antibody binds to Rhesus ZNF879.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a kruppel-associated box-containing zinc finger protein (KRAB-ZFP). The encoded protein contains an N-terminal kruppel-associated box (KRAB) domain and thirteen C-terminal C2H2-type zinc finger domains. The KRAB-ZFPs represent the largest family of mammalian transcriptional repressors, which function through the recruitment of the nuclear co-factor KRAB-Associated Protein 1 (KAP1), to engage histone modifiers and induce heterochromatin formation. (From NCBI)
Product OverviewMouse Anti-Rhesus ZNF879 Antibody is a mouse antibody against ZNF879. It can be used for ZNF879 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 879; ZNF879
UniProt IDH9EYX7
Protein RefseqThe length of the protein is 322 amino acids long.
The sequence is show below: MARRLLPAQVQESVTFRDVAVFFSQDEWLHLDSAQRALYREVMLENYSSLVSLGILFSKPKVISQLEQGEDPWMVESGVPQGAHLGWESLFEAIISKEENQEVMKKLIIDGAFDFKLEKTYINEDKLEKQQGKKNKLFRKVLVTIKKVYMKERSFKGIEFGKNLGLKSSLIRKPRMGSRGRRPHSQQYSVLFKQLGVNTVRKCYKCNICGKIFLHSSSLSKHQRIHTGEKLYKCKECRKAFSQSSSLTQHLRVHTGEKPYICSECGKAFSFTTSLIGHQRMHTGERPYKCKECGKTFKGSSSLNNHQRIHTGEKPYKCNECG.
For Research Use Only | Not For Clinical Use.
Online Inquiry