AibGenesis™ Mouse Anti-ZP4 Antibody (CBMOAB-63699FYA)
Cat: CBMOAB-63699FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-63699FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO63699FYA | 100 µg | ||
| MO-AB-09351W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09351W | 100 µg | ||
| MO-AB-09558H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO09558C | 100 µg | ||
| MO-AB-10573Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10573Y | 100 µg | ||
| MO-AB-23397R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO23397R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus) |
| Clone | MO63699FYA |
| Specificity | This antibody binds to Rhesus ZP4. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. Previously, this gene has been referred to as ZP1 or ZPB and thought to have similar functions as mouse Zp1. However, a human gene with higher similarity and chromosomal synteny to mouse Zp1 has been assigned the symbol ZP1 and this gene has been assigned the symbol ZP4. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus ZP4 Antibody is a mouse antibody against ZP4. It can be used for ZP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ZP4 |
| UniProt ID | F6UXP5 |
| Protein Refseq | The length of the protein is 477 amino acids long. The sequence is show below: MRLLQCVLLCVSLSLVLSGQHKPETPGYSSVLHCGLWSFQFAVNLSQEATSPPVLITWDNQGLLHKLQNDSDCGTWIRNGPGSSVVLEATYSSCYVTEWDSHYIMPVGVEGVGVAEHKMVPERKLLKCPMDLLARDAPDTDWCDSIPARDRLPCAPSPISRGDCEGLGCCYSSEEVNSCYYGNTVTLRCTREGHFSIAVSRNVASPPLLLDSVRLALRNDSACNPVMATQAFVLFQFPFTSCGTTRRITGDRAVYENELVATRDVKNGSRGSVTRDSIFRLHVSCSYSVSSNSLPIKVQVFTLPPPFPETQPGPLTLELQIAKDKNYGSYYGVGDYPVVKLLRDPIYVEVSILHRTDPSLGLLLHQCWATPSTDPLSQPQWPILVKGCPYIGDNYQTQLIPVQKALDLPFPSHYQRFSIFTFSFVDPTAEKQALRGPVHLHCSVSVCQPAETPSCAVTCPDLSREKKFRHHFSEHYC. |
For Research Use Only | Not For Clinical Use.
Online Inquiry