AibGenesis™ Mouse Anti-ZPBP2 Antibody (CBMOAB-63703FYA)


Cat: CBMOAB-63703FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63703FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Pig (Sus scrofa) WB, ELISA MO63703FYA 100 µg
MO-AB-04892Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04892Y 100 µg
MO-AB-09560H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09560C 100 µg
MO-AB-23399R Monoclonal Cattle (Bos taurus) WB, ELISA MO23399R 100 µg
MO-AB-31377R Monoclonal Pig (Sus scrofa) WB, ELISA MO31377R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Pig (Sus scrofa)
CloneMO63703FYA
SpecificityThis antibody binds to Rhesus ZPBP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZPBP2 Antibody is a mouse antibody against ZPBP2. It can be used for ZPBP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZPBP2
UniProt IDF7HGH6
Protein RefseqThe length of the protein is 326 amino acids long.
The sequence is show below: MRTWVLLSAVLWCLTGVRCPRSTLFNTKGFVYGKTGQPGKIYVKLHQNSPVLICMDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITKTGQLMVKDFLEPLSGLYTCTLSYKTVKAETQEEKTVKKRYDFMVFAYREPDYSYQMAVRFTTKSCIGRYNDVFFRVLKKILDNLMSDLSCHVIEPSYKCHSVEIPEHGLIHELFIAFQVNPFAPGWKGACNGSVDCEDITNRNILQARDRIEEFFWSQAYIFYHNFNKTLPAMHFVDHSLQVVRLDSCRPGFGKDESLHSNCASCCVVCSPATFSPDVDVTCQTCVSVLIYGAKSCP.
For Research Use Only | Not For Clinical Use.
Online Inquiry