AibGenesis™ Mouse Anti-ZSWIM4 Antibody (CBMOAB-63746FYA)


Cat: CBMOAB-63746FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-63746FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) WB, ELISA MO63746FYA 100 µg
MO-AB-07291W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07291W 100 µg
MO-AB-09569H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09569C 100 µg
MO-AB-16540W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16540W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis)
CloneMO63746FYA
SpecificityThis antibody binds to Rhesus ZSWIM4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ZSWIM4 Antibody is a mouse antibody against ZSWIM4. It can be used for ZSWIM4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger SWIM domain-containing protein 4; ZSWIM4
UniProt IDH9FHM6
Protein RefseqThe length of the protein is 187 amino acids long.
The sequence is show below: RVLQVGFHLSGNIREPGGPGEPERLYHVSISFDRCKITSVSCGCDNRDLFYCAHVVALSLYRIRHARQVELRLPISETLSQMNRDQLQKFVQYLISAHHTEVLPTAQRLADEILLLGSEINLVHGAPDPTAGAGIEDANCWHLDEEQIQEQVKQLLSNGGYYGASQQLRSMFSKVREMLRMRDSNGA.
For Research Use Only | Not For Clinical Use.
Online Inquiry