Mouse Anti-atpE Antibody (CBMOAB-0216YC)
Cat: CBMOAB-0216YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-0216YC | Monoclonal | E. coli (Escherichia coli ), A. thaliana (Arabidopsis thaliana), Arabidopsis, Rice, Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cottonwood (Populus deltoids), French-bean, Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) | WB, ELISA | MO0216YC | 100 µg | ||
| MOFAB-289W | Arabidopsis, Rice | WB | 100 µg | ||||
| CBMOAB-18721FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO18721FYB | 100 µg | ||
| CBMOAB-24879FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO24879FC | 100 µg | ||
| MO-AB-00042W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00042W | 100 µg | ||
| MO-AB-01780L | Monoclonal | Bromus (Bromus vulgaris) | WB, ELISA | MO01780L | 100 µg | ||
| MO-AB-27245W | Monoclonal | Cottonwood (Populus deltoids) | WB, ELISA | MO27245W | 100 µg | ||
| MO-AB-30218H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30218C | 100 µg | ||
| MO-AB-36078W | Monoclonal | French-bean | WB, ELISA | MO36078W | 100 µg | ||
| MO-AB-38863W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO38863W | 100 µg | ||
| MO-DKB-01641W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | E. coli (Escherichia coli ), A. thaliana (Arabidopsis thaliana), Arabidopsis, Rice, Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cottonwood (Populus deltoids), French-bean, Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) |
| Clone | MO0216YC |
| Specificity | This antibody binds to Escherichia coli K-12 atpE. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | FF ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F containing the extramembraneous catalytic core and F containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F is coupled via a rotary mechanism of the central stalk subunits to proton translocation. |
| Product Overview | Mouse Anti-E. coli atpE Antibody is a mouse antibody against atpE. It can be used for atpE detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ATP synthase subunit c; ATP synthase F(0) sector subunit c; Dicyclohexylcarbodiimide-binding protein; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein; atpE; papH uncE; b3737 JW3715 |
| UniProt ID | P68699 |
| Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFAVA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry