AibGenesis™ Mouse Anti-atpE Antibody (CBMOAB-0216YC)


Cat: CBMOAB-0216YC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-0216YC Monoclonal E. coli (Escherichia coli ), A. thaliana (Arabidopsis thaliana), Arabidopsis, Rice, Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cottonwood (Populus deltoids), French-bean, Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) WB, ELISA MO0216YC 100 µg
MOFAB-289W Arabidopsis, Rice WB 100 µg
CBMOAB-18721FYB Monoclonal Rice (Oryza) WB, ELISA MO18721FYB 100 µg
CBMOAB-24879FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO24879FC 100 µg
MO-AB-00042W Monoclonal Barrel medic (Medicago truncatula) WB, ELISA MO00042W 100 µg
MO-AB-01780L Monoclonal Bromus (Bromus vulgaris) WB, ELISA MO01780L 100 µg
MO-AB-27245W Monoclonal Cottonwood (Populus deltoids) WB, ELISA MO27245W 100 µg
MO-AB-30218H Monoclonal Sugar beet (Beta vulgaris) WB, ELISA MO30218C 100 µg
MO-AB-36078W Monoclonal French-bean WB, ELISA MO36078W 100 µg
MO-AB-38863W Monoclonal Grape (Vitis vinifera) WB, ELISA MO38863W 100 µg
MO-DKB-01641W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli ), A. thaliana (Arabidopsis thaliana), Arabidopsis, Rice, Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cottonwood (Populus deltoids), French-bean, Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris)
CloneMO0216YC
SpecificityThis antibody binds to Escherichia coli K-12 atpE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-E. coli atpE Antibody is a mouse antibody against atpE. It can be used for atpE detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP synthase subunit c; ATP synthase F(0) sector subunit c; Dicyclohexylcarbodiimide-binding protein; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein; atpE; papH uncE; b3737 JW3715
UniProt IDP68699
Protein RefseqThe length of the protein is 79 amino acids long. The sequence is show below: MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFAVA.
For Research Use Only | Not For Clinical Use.
Online Inquiry