Mouse Anti-atpH Antibody (CBMOAB-0219YC)
Cat: CBMOAB-0219YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-0219YC | Monoclonal | WB, ELISA | MO0219YC | 100 µg | |||
| CBMOAB-18725FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO18725FYB | 100 µg | ||
| CBMOAB-24883FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO24883FC | 100 µg | ||
| MO-AB-00045W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00045W | 100 µg | ||
| MO-AB-30220H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30220C | 100 µg | ||
| MO-AB-34206H | Monoclonal | Tomato (Lycopersicon esculentum) | WB, ELISA | MO34206C | 100 µg | ||
| MO-AB-47436W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO47436W | 100 µg | ||
| MO-DKB-0077RA | Polyclonal | WB | 200 µL | ||||
| MO-DKB-0078RA | Polyclonal | WB | 100 µL | ||||
| MO-DKB-02614W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | E. coli (Escherichia coli ), A. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); C. reinhardtii (Chlamydomonas reinhardtii), A. thaliana (Arabidopsis thaliana); N. benthamina (Nicotiana benthamina); Spinach (Spinacia oleracea); T. elongatus (Thermosynechococcus elongatus), Barrel medic (Medicago truncatula), Maize (Zea mays), Rice (Oryza), Sugar beet (Beta vulgaris), Tomato (Lycopersicon esculentum) |
| Clone | MO0219YC |
| Specificity | This antibody binds to Escherichia coli K-12 atpH. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | FF ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F containing the extramembraneous catalytic core and F containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F is coupled via a rotary mechanism of the central stalk subunits to proton translocation. |
| Product Overview | Mouse Anti-E. coli atpH Antibody is a mouse antibody against atpH. It can be used for atpH detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ATP synthase subunit delta; ATP synthase F(1) sector subunit delta; F-type ATPase subunit delta; F-ATPase subunit delta; atpH; papE uncH; b3735 JW3713 |
| UniProt ID | P0ABA4 |
| Protein Refseq | The length of the protein is 177 amino acids long. The sequence is show below: MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGALAPETLAESFIAVCGEQLDENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKLNCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLADVLQS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry