AibGenesis™ Mouse Anti-csrA Antibody (CBMOAB-0450YC)
Cat: CBMOAB-0450YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-0450YC | Monoclonal | E. coli (Escherichia coli ), E. coli (Escherichia coli) | WB, ELISA | MO0450YC | 100 µg | ||
| MO-DKB-00178W | Polyclonal | E. coli (Escherichia coli) | ELISA | 100 µg | |||
| MO-DKB-00184W | Polyclonal | E. coli (Escherichia coli) | ELISA, WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | E. coli (Escherichia coli ), E. coli (Escherichia coli) |
| Clone | MO0450YC |
| Specificity | This antibody binds to Escherichia coli K-12 csrA. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | A key translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability, initially identified for its effects on central carbon metabolism (PubMed:8393005). Mediates global changes in gene expression, shifting from rapid growth to stress survival by linking envelope stress, the stringent response and the catabolite repression systems (PubMed:21488981, PubMed:28924029). Binds to the 5'-UTR of mRNA to repress or activate translation; 2 binding sites on the homodimer can bridge 2 sites within target RNA. Exerts reciprocal effects on enzymes of gluconeogenesis and glycogen biosynthesis versus those of glycolysis (PubMed:7493933, PubMed:16923806). Negatively effects glycogen biosynthesis, gluconeogenesis, alters cell size and surface properties (PubMed:8393005, PubMed:7751274, PubMed:7493933). Activates regulates expression of glycolysis genes (PubMed:7493933). Represses biofilm formation (PubMed:11741870). Regulates glycogen synthesis under both aerobic and anaerobic conditions; overexpression strongly inhibits glycogen accumulation (PubMed:8393005). Binds to 4 sites in its own promoter, including the Shine-Dalgarno sequence, repressing its own translation; mutating the binding-sites decreases repression (PubMed:21696456). Indirectly activates transcription from 1 of its 5 promoters, which is responsible for increased expression during stationary phase (PubMed:21696456). Binds to at least 720 transcripts in strain K12 / CF7789, many of which are also part of the stringent response, including relA, spoT and dksA; slightly represses RelA and slightly activates DskA translation (PubMed:21488981). Binds to and represses the ECF sigma factor rpoE promoter (PubMed:28924029). Accelerates the degradation of glgC gene transcripts; overexpression further decreases glgC transcripts (PubMed:7751274). Binds 2 sites in the glgC mRNA leader, 1 of which overlaps the Shine-Dalgarno sequence, preventing ribosome-binding and thus destabilizing the mRNA (PubMed:12067347). Acts to inhibit interaction between the CcdB (also known as LetD) protein and the A subunit of DNA gyrase (PubMed:8604133). Required to activate motility and flagellum biosynthesis through the post-transcriptional activation of flhDC expression by binding to and stabilizing the flhDC message (PubMed:11298291). Represses translation of iraD mRNA via translational coupling to an upstream open reading frame (PubMed:28851853). Binds to mRNA and reduces levels of probable diguanylate cyclases dgcT and dgcZ (PubMed:18713317). (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-E. coli csrA Antibody is a mouse antibody against csrA. It can be used for csrA detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Carbon storage regulator; csrA; zfiA; b2696 JW2666 |
| UniProt ID | P69913 |
| Protein Refseq | The length of the protein is 61 amino acids long. The sequence is show below: MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry