Mouse Anti-E. coli acpT Antibody (CBMOAB-0027YC)


Cat: CBMOAB-0027YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli )
CloneMO0027YC
SpecificityThis antibody binds to Escherichia coli K-12 acpT.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay be involved in an alternative pathway for phosphopantetheinyl transfer and holo-ACP synthesis in E.coli. The native apo-protein substrate is unknown. Is able to functionally replace AcpS in vivo but only when expressed at high levels.
Product OverviewMouse Anti-E. coli acpT (clone MO0027YC) Antibody (CBMOAB-0027YC) is a mouse antibody against acpT. It can be used for acpT detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative Names4'-phosphopantetheinyl transferase AcpT; EC 2.7.8.-; acpT; yhhU; b3475 JW3440
UniProt IDP37623
Protein RefseqThe length of the protein is 195 amino acids long. The sequence is show below: MYRIVLGKVSTLSAAPLPPGLREQAPQGPRRERWLAGRALLSHTLSPLPEIIYGEQGKPAFAPEMPLWFNLSHSGDDIALLLSDEGEVGCDIEVIRPRANWRWLANAVFSLGEHAEMDAVHPDQQLEMFWRIWTRKEAIVKQRGGSAWQIVSVDSTYHSSLSVSHCQLENLSLAICTPTPFTLTADSVQWIDSVN.
For Research Use Only | Not For Clinical Use.

Online Inquiry