Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-E. coli acpT Antibody (CBMOAB-0027YC)


Cat: CBMOAB-0027YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli )
CloneMO0027YC
SpecificityThis antibody binds to Escherichia coli K-12 acpT.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay be involved in an alternative pathway for phosphopantetheinyl transfer and holo-ACP synthesis in E.coli. The native apo-protein substrate is unknown. Is able to functionally replace AcpS in vivo but only when expressed at high levels.
Product OverviewMouse Anti-E. coli acpT (clone MO0027YC) Antibody (CBMOAB-0027YC) is a mouse antibody against acpT. It can be used for acpT detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative Names4'-phosphopantetheinyl transferase AcpT; EC 2.7.8.-; acpT; yhhU; b3475 JW3440
UniProt IDP37623
Protein RefseqThe length of the protein is 195 amino acids long. The sequence is show below: MYRIVLGKVSTLSAAPLPPGLREQAPQGPRRERWLAGRALLSHTLSPLPEIIYGEQGKPAFAPEMPLWFNLSHSGDDIALLLSDEGEVGCDIEVIRPRANWRWLANAVFSLGEHAEMDAVHPDQQLEMFWRIWTRKEAIVKQRGGSAWQIVSVDSTYHSSLSVSHCQLENLSLAICTPTPFTLTADSVQWIDSVN.
For Research Use Only | Not For Clinical Use.

Online Inquiry