Mouse Anti-E. coli add Antibody (CBMOAB-0039YC)


Cat: CBMOAB-0039YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli )
CloneMO0039YC
SpecificityThis antibody binds to Escherichia coli K-12 add.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-E. coli add (clone MO0039YC) Antibody (CBMOAB-0039YC) is a mouse antibody against add. It can be used for add detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenosine deaminase; EC 3.5.4.4; Adenosine aminohydrolase; add; b1623 JW1615
UniProt IDP22333
Protein RefseqThe length of the protein is 333 amino acids long. The sequence is show below: MIDTTLPLTDIHRHLDGNIRPQTILELGRQYNISLPAQSLETLIPHVQVIANEPDLVSFLTKLDWGVKVLASLDACRRVAFENIEDAARHGLHYVELRFSPGYMAMAHQLPVAGVVEAVIDGVREGCRTFGVQAKLIGIMSRTFGEAACQQELEAFLAHRDQITALDLAGDELGFPGSLFLSHFNRARDAGWHITVHAGEAAGPESIWQAIRELGAERIGHGVKAIEDRALMDFLAEQQIGIESCLTSNIQTSTVAELAAHPLKTFLEHGIRASINTDDPGVQGVDIIHEYTVAAPAAGLSREQIRQAQINGLEMAFLSAEEKRALREKVAAK.

See other products for " add "

For Research Use Only | Not For Clinical Use.

Online Inquiry