Mouse Anti-E. coli arcA2 Antibody (CBMOAB-0132YC)
Cat: CBMOAB-0132YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | E. coli (Escherichia coli ) |
| Clone | MO0132YC |
| Specificity | This antibody binds to Escherichia coli K-12 arcA2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-E. coli arcA2 Antibody is a mouse antibody against arcA2. It can be used for arcA2 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Disrupted ArcA; Fragment; arcA2 |
| UniProt ID | A5PFJ8 |
| Protein Refseq | The length of the protein is 71 amino acids long. The sequence is show below: AMLHFCENPGKIQSRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEIIATIHGEGYRFCGDLED. |
For Research Use Only | Not For Clinical Use.
Online Inquiry