Mouse Anti-E. coli arcA2 Antibody (CBMOAB-0132YC)


Cat: CBMOAB-0132YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli )
CloneMO0132YC
SpecificityThis antibody binds to Escherichia coli K-12 arcA2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-E. coli arcA2 (clone MO0132YC) Antibody (CBMOAB-0132YC) is a mouse antibody against arcA2. It can be used for arcA2 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesDisrupted ArcA; Fragment; arcA2
UniProt IDA5PFJ8
Protein RefseqThe length of the protein is 71 amino acids long. The sequence is show below: AMLHFCENPGKIQSRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEIIATIHGEGYRFCGDLED.

Reference

See other products for " arcA2 "

For Research Use Only | Not For Clinical Use.

Online Inquiry