AibGenesis™ Mouse Anti-dtd Antibody (CBMOAB-0621YC)
Cat: CBMOAB-0621YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | E. coli (Escherichia coli ), Fruit fly (Drosophila melanogaster) |
| Clone | MO0621YC |
| Specificity | This antibody binds to Escherichia coli K-12 dtd. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs, has no observable editing activity on tRNAs charged with cognate L-amino acid (PubMed:10383414, PubMed:4292198, PubMed:10918062, PubMed:24302572, PubMed:27224426). Edits mischarged glycyl-tRNA(Ala) more efficiently than AlaRS (PubMed:28362257). Acts via tRNA-based rather than protein-based catalysis (PubMed:24302572, PubMed:27224426, PubMed:28362257). Rejects correctly charged L-amino acid-tRNAs from its binding site rather than specifically recognizing incorrectly charged D-amino acid-tRNAs (PubMed:27224426). Hydrolyzes correctly charged, achiral, glycyl-tRNA(Gly); GTP-bound EF-Tu (tested with T.thermophilus EF-Tu AC Q5SHN6) protects charged glycyl-tRNA(Gly) from hydrolysis, while increasing Dtd levels or inactivating EF-Tu decreases protection (PubMed:27224426). Hydrolyzes mischarged glycyl-tRNA(Ala) (but not seryl-tRNA(Ala)) even in the presence of EF-Tu, edits about 4-fold better than the editing domain of AlaRS (PubMed:28362257). Has greater activity on glycyl-tRNA(Ala) than glycyl-tRNA(Gly) due in part to its recognition of the conserved tRNA(Ala) G3.U70 wobble base pair (PubMed:28362257). Binds D-amino acids but not L-amino acids (PubMed:16902403). Overexpression of E.coli or P.falciparum Dtd is toxic in E.coli, toxicity can be rescued by supplementation with Gly (PubMed:27224426). By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality (PubMed:15292242). Hydrolyzes D-tyrosyl-tRNA(Tyr) (PubMed:4292198, PubMed:10383414, PubMed:24302572, PubMed:27224426). Hydrolyzes D-phenylalanyl-tRNA(Phe) (PubMed:4292198, PubMed:24302572). Hydrolyzes D-aspartyl-tRNA(Asp) (PubMed:10918062). Hydrolyzes D-tryptophanyl-tRNA(Trp) (PubMed:10918062). Hydrolyzes glycyl-tRNA(Gly) (PubMed:27224426). Hydrolyzes glycyl-tRNA(Ala) (PubMed:28362257). (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-E. coli dtd Antibody is a mouse antibody against dtd. It can be used for dtd detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | D-aminoacyl-tRNA deacylase; EC 3.1.1.96; D-tyrosyl-tRNA(Tyr) deacylase; dtd; yihZ; b3887 JW3858 |
| UniProt ID | P0A6M4 |
| Protein Refseq | The length of the protein is 145 amino acids long. The sequence is show below: MIALIQRVTRASVTVEGEVTGEIGAGLLVLLGVEKDDDEQKANRLCERVLGYRIFSDAEGKMNLNVQQAGGSVLVVSQFTLAADTERGMRPSFSKGASPDRAEALYDYFVERCRQQEMNTQTGRFAADMQVSLVNDGPVTFWLQV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry