AibGenesis™ Mouse Anti-hns Antibody (CBMOAB-1191YC)


Cat: CBMOAB-1191YC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-1191YC Monoclonal E. coli (Escherichia coli ), E. coli (Escherichia coli) WB, ELISA MO1191YC 100 µg
Inquiry
MO-DKB-00009W Polyclonal E. coli (Escherichia coli) ELISA 100 µg
Inquiry
MO-DKB-00010W Polyclonal E. coli (Escherichia coli) IA 100 µg
Inquiry
MO-DKB-00012W Polyclonal E. coli (Escherichia coli) ELISA, WB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli ), E. coli (Escherichia coli)
CloneMO1191YC
SpecificityThis antibody binds to Escherichia coli K-12 hns.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionA DNA-binding protein implicated in transcriptional repression (silencing) (PubMed:333393, PubMed:2128918, PubMed:8890170, PubMed:8913298, PubMed:9398522, PubMed:16963779, PubMed:17046956, PubMed:23543115). Also involved in bacterial chromosome organization and compaction (PubMed:6379600, PubMed:10982869, PubMed:21903814). H-NS binds tightly to AT-rich dsDNA and inhibits transcription (PubMed:2512122, PubMed:16963779, PubMed:17435766, PubMed:17881364, PubMed:23543115). Binds upstream and downstream of initiating RNA polymerase, trapping it in a loop and preventing transcription (PubMed:11714691). Binds to hundreds of sites, approximately half its binding sites are in non-coding DNA, which only accounts for about 10% of the genome (PubMed:16963779, PubMed:17046956, PubMed:23543115). Many of these loci were horizontally transferred (HTG); this offers the selective advantage of silencing foreign DNA while keeping it in the genome in case of need (PubMed:17046956, PubMed:17881364, PubMed:26789284). Suppresses transcription at many intragenic sites as well as transcription of spurious, non-coding RNAs genome-wide (PubMed:24449106). Repression of HTG by H-NS is thought to allow their DNA to evolve faster than non-H-NS-bound regions, and facilitates integration of HTG into transcriptional regulatory networks (PubMed:26789284). A subset of H-NS/StpA-regulated genes also require Hha (and/or Cnu, ydgT) for repression; Hha and Cnu increase the number of genes DNA bound by H-NS/StpA and may also modulate the oligomerization of the H-NS/StpA-complex (PubMed:23543115). The protein forms 2 clusters in the nucleoid which gather hns-bound loci together, bridging non-contiguous DNA, and causes DNA substantial condensation (PubMed:21903814). Binds DNA better at low temperatures than at 37 degrees Celsius; AT-rich sites nucleate H-NS binding, further DNA-binding is cooperative and this cooperativity decreases with rising temperature (PubMed:17435766, PubMed:17881364). Transcriptional repression can be inhibited by dominant-negative mutants of StpA or itself (PubMed:8755860). May effect transcriptional elongation (PubMed:25638302). Can increase translational efficiency of mRNA with suboptimal Shine-Dalgarno sequences (PubMed:20595230). Plays a role in the thermal control of pili and adhesive curli fimbriae production, by inducing transcription of csgD (PubMed:17010156). Plays a role in flagellar function (PubMed:11031114). Represses the CRISPR-cas promoters, permits only weak transcription of the crRNA precursor; its repression is antagonized by LeuO (PubMed:20132443, PubMed:20659289). Binds preferentially to the upstream region of its own gene recognizing two segments of DNA on both sides of a bend centered around -150 (PubMed:7934818). Overexpression suppresses secY24, a temperature-sensitive mutation (PubMed:1537791). Has also been reported to activate transcription of some genes (PubMed:4566454, PubMed:338303, PubMed:2128918). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-E. coli hns Antibody is a mouse antibody against hns. It can be used for hns detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesDNA-binding protein H-NS; Histone-like protein HLP-II; Protein B1; Protein H1; hns; bglY cur drdX hnsA msyA osmZ pilG topS; b1237 JW1225
UniProt IDP0ACF8
Protein RefseqThe length of the protein is 137 amino acids long. The sequence is show below: MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry