Mouse Anti-hyi Antibody (CBMOAB-1270YC)
Cat: CBMOAB-1270YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-1270YC | Monoclonal | E. coli (Escherichia coli ), Cattle (Bos taurus), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Silkworm (Bombyx mori), Zebrafish (Danio rerio) | WB, ELISA | MO1270YC | 100 µg | ||
CBMOAB-44971FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO44971FYA | 100 µg | ||
CBMOAB-80198FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO80198FYA | 100 µg | ||
MO-AB-00644L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00644L | 100 µg | ||
MO-AB-00741R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00741R | 100 µg | ||
MO-AB-08426Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08426Y | 100 µg | ||
MO-AB-13917R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13917R | 100 µg | ||
MO-AB-26444R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26444R | 100 µg | ||
MO-AB-33314H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33314C | 100 µg | ||
MO-AB-34913W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34913W | 100 µg | ||
MO-AB-41841W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41841W | 100 µg | ||
MO-AB-57072W | Monoclonal | Marmoset | WB, ELISA | MO57072W | 100 µg | ||
MO-AB-69961W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO69961W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | E. coli (Escherichia coli ), Cattle (Bos taurus), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Silkworm (Bombyx mori), Zebrafish (Danio rerio) |
Clone | MO1270YC |
Specificity | This antibody binds to Escherichia coli K-12 hyi. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Catalyzes the reversible isomerization between hydroxypyruvate and 2-hydroxy-3-oxopropanoate (also termed tartronate semialdehyde). Does not catalyze the isomerization of D-fructose to D-glucose or that of D-xylulose to D-xylose. Also does not catalyze racemization of serine, alanine, glycerate or lactate. |
Product Overview | Mouse Anti-E. coli hyi Antibody is a mouse antibody against hyi. It can be used for hyi detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Hydroxypyruvate isomerase; EC 5.3.1.22; Glyoxylate-induced protein; hyi; gip ybbG; b0508 JW0496 |
UniProt ID | P30147 |
Protein Refseq | The length of the protein is 258 amino acids long. The sequence is show below: MLRFSANLSMLFGEYDFLARFEKAAQCGFRGVEFMFPYDYDIEELKHVLASNKLEHTLHNLPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARALGNKKINCLVGKTPAGFSSEQIHATLVENLRYAANMLMKEDILLLIEPINHFDIPGFHLTGTRQALKLIDDVGCCNLKIQYDIYHMQRMEGELTNTMTQWADKIGHLQIADNPHRGEPGTGEINYDYLFKVIENSDYNGWVGCEYKPQTTTEAGLRWMDPYR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry