Mouse Anti-infA Antibody (CBMOAB-1315YC)
Cat: CBMOAB-1315YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-1315YC | Monoclonal | E. coli (Escherichia coli ), Bromus (Bromus vulgaris), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) | WB, ELISA | MO1315YC | 100 µg | ||
CBMOAB-23308FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO23308FYB | 100 µg | ||
MO-AB-01858L | Monoclonal | Bromus (Bromus vulgaris) | WB, ELISA | MO01858L | 100 µg | ||
MO-AB-30287H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30287C | 100 µg | ||
MO-AB-39160W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO39160W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | E. coli (Escherichia coli ), Bromus (Bromus vulgaris), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) |
Clone | MO1315YC |
Specificity | This antibody binds to Escherichia coli K-12 infA. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | One of the essential components for the initiation of protein synthesis. Binds in the vicinity of the A-site. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit, IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex. |
Product Overview | Mouse Anti-E. coli infA Antibody is a mouse antibody against infA. It can be used for infA detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Translation initiation factor IF-1; infA; b0884 JW0867 |
UniProt ID | P69222 |
Protein Refseq | The length of the protein is 72 amino acids long. The sequence is show below: MAKEDNIEMQGTVLETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRSR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry