Mouse Anti-infA Antibody (CBMOAB-1315YC)


Cat: CBMOAB-1315YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-1315YC Monoclonal E. coli (Escherichia coli ), Bromus (Bromus vulgaris), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) WB, ELISA MO1315YC 100 µg
CBMOAB-23308FYB Monoclonal Rice (Oryza) WB, ELISA MO23308FYB 100 µg
MO-AB-01858L Monoclonal Bromus (Bromus vulgaris) WB, ELISA MO01858L 100 µg
MO-AB-30287H Monoclonal Sugar beet (Beta vulgaris) WB, ELISA MO30287C 100 µg
MO-AB-39160W Monoclonal Grape (Vitis vinifera) WB, ELISA MO39160W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli ), Bromus (Bromus vulgaris), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris)
CloneMO1315YC
SpecificityThis antibody binds to Escherichia coli K-12 infA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-E. coli infA Antibody is a mouse antibody against infA. It can be used for infA detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranslation initiation factor IF-1; infA; b0884 JW0867
UniProt IDP69222
Protein RefseqThe length of the protein is 72 amino acids long. The sequence is show below: MAKEDNIEMQGTVLETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRSR.
For Research Use Only | Not For Clinical Use.
Online Inquiry