Mouse Anti-iraP Antibody (CBMOAB-1401YC)
Cat: CBMOAB-1401YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- QC data
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | E. coli (Escherichia coli ), Pig (Sus scrofa) |
Clone | MO1401YC |
Specificity | This antibody binds to Escherichia coli K-12 iraP. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-E. coli iraP (clone MO1401YC) Antibody (CBMOAB-1401YC) is a mouse antibody against iraP. It can be used for iraP detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Anti-adapter protein IraP; iraP; yaiB; b0382 JW0373 |
UniProt ID | P0AAN9 |
Protein Refseq | The length of the protein is 86 amino acids long. The sequence is show below: MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQQRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPRQ. |
See other products for " iraP "
Relate Reference Data

ELISA
Figure 1 Mouse Anti-E. coli iraP Antibody (CBMOAB-1401YC) in ELISA.
ELISA analysis of CBMOAB-1401YC (Lot#CB2106Y18P4) with peptide antigen, MKNLIAELLFK.

For Research Use Only | Not For Clinical Use.
Online Inquiry