Mouse Anti-iraP Antibody (CBMOAB-1401YC)
Cat: CBMOAB-1401YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- QC data
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | E. coli (Escherichia coli ), Pig (Sus scrofa) |
Clone | MO1401YC |
Specificity | This antibody binds to Escherichia coli K-12 iraP. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Inhibits RpoS proteolysis by regulating RssB activity, thereby increasing the stability of the sigma stress factor RpoS especially during phosphate starvation, but also in stationary phase and during nitrogen starvation. Its effect on RpoS stability is due to its interaction with RssB, which probably blocks the interaction of RssB with RpoS, and the consequent delivery of the RssB-RpoS complex to the ClpXP protein degradation pathway. |
Product Overview | Mouse Anti-E. coli iraP (clone MO1401YC) Antibody (CBMOAB-1401YC) is a mouse antibody against iraP. It can be used for iraP detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Anti-adapter protein IraP; iraP; yaiB; b0382 JW0373 |
UniProt ID | P0AAN9 |
Protein Refseq | The length of the protein is 86 amino acids long. The sequence is show below: MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQQRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPRQ. |
See other products for " iraP "
Relate Reference Data
ELISA
Figure 1 Mouse Anti-E. coli iraP Antibody (CBMOAB-1401YC) in ELISA.
ELISA analysis of CBMOAB-1401YC (Lot#CB2106Y18P4) with peptide antigen, MKNLIAELLFK.
For Research Use Only | Not For Clinical Use.
Online Inquiry