Mouse Anti-ppiB Antibody (CBMOAB-2102YC)
Cat: CBMOAB-2102YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-2102YC | Monoclonal | E. coli (Escherichia coli ), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Goat (Capra hircus), Gorilla, Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO2102YC | 100 µg | ||
CBMOAB-93505FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO93505FYA | 100 µg | ||
MO-AB-01151L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01151L | 100 µg | ||
MO-AB-01349R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01349R | 100 µg | ||
MO-AB-06458H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO06458C | 100 µg | ||
MO-AB-06784Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06784Y | 100 µg | ||
MO-AB-08729W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08729W | 100 µg | ||
MO-AB-09461Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09461Y | 100 µg | ||
MO-AB-17191Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17191Y | 100 µg | ||
MO-AB-18323R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO18323R | 100 µg | ||
MO-AB-20184W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20184W | 100 µg | ||
MO-AB-27994H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27994C | 100 µg | ||
MO-AB-33656H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33656C | 100 µg | ||
MO-AB-35489W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35489W | 100 µg | ||
MO-AB-38008W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38008W | 100 µg | ||
MO-AB-38718W | Monoclonal | Gorilla | WB, ELISA | MO38718W | 100 µg | ||
MO-AB-46135W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46135W | 100 µg | ||
MO-AB-62045W | Monoclonal | Marmoset | WB, ELISA | MO62045W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | E. coli (Escherichia coli ), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Goat (Capra hircus), Gorilla, Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO2102YC |
Specificity | This antibody binds to Escherichia coli K-12 ppiB. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. |
Product Overview | Mouse Anti-E. coli ppiB Antibody is a mouse antibody against ppiB. It can be used for ppiB detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Peptidyl-prolyl cis-trans isomerase B; PPIase B; EC 5.2.1.8; Rotamase B; ppiB; b0525 JW0514 |
UniProt ID | P23869 |
Protein Refseq | The length of the protein is 164 amino acids long. The sequence is show below: MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVINGFMIQGGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVDNDFLNFSGESLQGWGYCVFAEVVDGMDVVDKIKGVATGRSGMHQDVPKEDVIIESVTVSE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry