Mouse Anti-rbfA Antibody (CBMOAB-2245YC)


Cat: CBMOAB-2245YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-2245YC Monoclonal E. coli (Escherichia coli ), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO2245YC 100 µg
CBMOAB-56144FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO56144FYA 100 µg
CBMOAB-64044FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64044FYA 100 µg
MO-AB-05561W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05561W 100 µg
MO-AB-26555W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26555W 100 µg
MO-AB-28367H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28367C 100 µg
MO-AB-63028W Monoclonal Marmoset WB, ELISA MO63028W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli ), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO2245YC
SpecificityThis antibody binds to Escherichia coli K-12 rbfA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOne of at least 4 proteins (Era, RbfA, RimM and RsgA/YjeQ) that assist in the late maturation steps of the functional core of the 30S subunit. Essential for efficient processing of pre-16S rRNA (PubMed:9422595, PubMed:12963368, PubMed:12628255). Probably part of the 30S subunit prior to or during the final step in the processing of 16S free 30S ribosomal subunits. Probably interacts with the 5'-terminal helix region of 16S rRNA (PubMed:7535280). Has affinity for free ribosomal 30S subunits but not for 70S ribosomes (PubMed:7535280, PubMed:12963368). Overexpression suppresses a cold-sensitive C23U 16S rRNA mutation (PubMed:7535280). Overexpression decreases the lag time following cold-shock by about half, leading to faster adaptation and increased protein synthesis (PubMed:8898389). Overexpression also partially suppresses a rimM deletion mutant and partially rescues its 16S rRNA processing deficiency (PubMed:9422595). Its function overlaps that of Era in ribosome biogenesis (PubMed:16825789). A number of RbfA mutants suppress RsgA/YjeQ deletions, in all cases less RbfA is bound to the 30S ribosome (PubMed:21102555). Released from 30S ribosomes by RsgA; stimulates the ribosome-associated GTPase activity of RsgA (PubMed:21102555). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-E. coli rbfA Antibody is a mouse antibody against rbfA. It can be used for rbfA detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibosome-binding factor A; Protein P15B; rbfA; P15B yhbB; b3167 JW3136
UniProt IDP0A7G2
Protein RefseqThe length of the protein is 133 amino acids long. The sequence is show below: MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED.
For Research Use Only | Not For Clinical Use.
Online Inquiry