Mouse Anti-rbfA Antibody (CBMOAB-2245YC)
Cat: CBMOAB-2245YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-2245YC | Monoclonal | E. coli (Escherichia coli ), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO2245YC | 100 µg | ||
| CBMOAB-56144FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO56144FYA | 100 µg | ||
| CBMOAB-64044FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO64044FYA | 100 µg | ||
| MO-AB-05561W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO05561W | 100 µg | ||
| MO-AB-26555W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26555W | 100 µg | ||
| MO-AB-28367H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28367C | 100 µg | ||
| MO-AB-63028W | Monoclonal | Marmoset | WB, ELISA | MO63028W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | E. coli (Escherichia coli ), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO2245YC |
| Specificity | This antibody binds to Escherichia coli K-12 rbfA. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | One of at least 4 proteins (Era, RbfA, RimM and RsgA/YjeQ) that assist in the late maturation steps of the functional core of the 30S subunit. Essential for efficient processing of pre-16S rRNA (PubMed:9422595, PubMed:12963368, PubMed:12628255). Probably part of the 30S subunit prior to or during the final step in the processing of 16S free 30S ribosomal subunits. Probably interacts with the 5'-terminal helix region of 16S rRNA (PubMed:7535280). Has affinity for free ribosomal 30S subunits but not for 70S ribosomes (PubMed:7535280, PubMed:12963368). Overexpression suppresses a cold-sensitive C23U 16S rRNA mutation (PubMed:7535280). Overexpression decreases the lag time following cold-shock by about half, leading to faster adaptation and increased protein synthesis (PubMed:8898389). Overexpression also partially suppresses a rimM deletion mutant and partially rescues its 16S rRNA processing deficiency (PubMed:9422595). Its function overlaps that of Era in ribosome biogenesis (PubMed:16825789). A number of RbfA mutants suppress RsgA/YjeQ deletions, in all cases less RbfA is bound to the 30S ribosome (PubMed:21102555). Released from 30S ribosomes by RsgA; stimulates the ribosome-associated GTPase activity of RsgA (PubMed:21102555). |
| Product Overview | Mouse Anti-E. coli rbfA Antibody is a mouse antibody against rbfA. It can be used for rbfA detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Ribosome-binding factor A; Protein P15B; rbfA; P15B yhbB; b3167 JW3136 |
| UniProt ID | P0A7G2 |
| Protein Refseq | The length of the protein is 133 amino acids long. The sequence is show below: MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED. |
For Research Use Only | Not For Clinical Use.
Online Inquiry