Mouse Anti-relB Antibody (CBMOAB-2285YC)
Cat: CBMOAB-2285YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-2285YC | Monoclonal | E. coli (Escherichia coli ), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO2285YC | 100 µg | ||
CBMOAB-56326FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO56326FYA | 100 µg | ||
CBMOAB-95674FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO95674FYA | 100 µg | ||
MO-AB-20217W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20217W | 100 µg | ||
MO-AB-28412H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28412C | 100 µg | ||
MO-AB-63178W | Monoclonal | Marmoset | WB, ELISA | MO63178W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | E. coli (Escherichia coli ), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO2285YC |
Specificity | This antibody binds to Escherichia coli K-12 relB. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Antitoxin component of a type II toxin-antitoxin (TA) system. Counteracts the effect of cognate toxin RelE via direct protein-protein interaction, preventing RelE from entering the ribosome A site and thus inhibiting its endoribonuclease activity. An autorepressor of relBE operon transcription. 2 RelB dimers bind to 2 operator sequences; DNA-binding and repression is stronger when complexed with toxin/corepressor RelE by conditional cooperativity (PubMed:18501926, PubMed:22981948). Increased transcription rate of relBE and activation of relE is consistent with a lower level of RelB in starved cells due to degradation of RelB by protease Lon. (From uniprot, under CC BY 4.0) |
Product Overview | Mouse Anti-E. coli relB Antibody is a mouse antibody against relB. It can be used for relB detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Antitoxin RelB; relB; b1564 JW1556 |
UniProt ID | P0C079 |
Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry