Mouse Anti-relB Antibody (CBMOAB-2285YC)


Cat: CBMOAB-2285YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-2285YC Monoclonal E. coli (Escherichia coli ), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO2285YC 100 µg
CBMOAB-56326FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO56326FYA 100 µg
CBMOAB-95674FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95674FYA 100 µg
MO-AB-20217W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20217W 100 µg
MO-AB-28412H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28412C 100 µg
MO-AB-63178W Monoclonal Marmoset WB, ELISA MO63178W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityE. coli (Escherichia coli ), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO2285YC
SpecificityThis antibody binds to Escherichia coli K-12 relB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAntitoxin component of a type II toxin-antitoxin (TA) system. Counteracts the effect of cognate toxin RelE via direct protein-protein interaction, preventing RelE from entering the ribosome A site and thus inhibiting its endoribonuclease activity. An autorepressor of relBE operon transcription. 2 RelB dimers bind to 2 operator sequences; DNA-binding and repression is stronger when complexed with toxin/corepressor RelE by conditional cooperativity (PubMed:18501926, PubMed:22981948). Increased transcription rate of relBE and activation of relE is consistent with a lower level of RelB in starved cells due to degradation of RelB by protease Lon. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-E. coli relB Antibody is a mouse antibody against relB. It can be used for relB detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesAntitoxin RelB; relB; b1564 JW1556
UniProt IDP0C079
Protein RefseqThe length of the protein is 79 amino acids long. The sequence is show below: MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry