AibGenesis™ Mouse Anti-septin3 Antibody (CBMOAB-97655FYA)


Cat: CBMOAB-97655FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-97655FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Rhesus (Macaca mulatta) WB, ELISA MO97655FYA 100 µg
MO-AB-05886W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05886W 100 µg
MO-AB-19943R Monoclonal Cattle (Bos taurus) WB, ELISA MO19943R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Rhesus (Macaca mulatta)
CloneMO97655FYA
SpecificityThis antibody binds to Zebrafish 44077.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish 44077 Antibody is a mouse antibody against 44077. It can be used for 44077 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNeuronal-specific septin-3; sept3; NP_001019589.
UniProt IDA2BGU8
Protein RefseqThe length of the protein is 361 amino acids long.
The sequence is show below: MSEIVPPEVRPKPAVPAKPSHVAPPSSAPFVPSPQGTGGEGQGSGRGSALLGYIGIDTIIEQMRKKTMKAGFDFNIMVVGQSGLGKSTLVNTLFKSQVSRRSTSWSRDEKIPKTVEIKSVSHVIEEGGVKMKLTVVDTPGFGDQINNDNCWEPISKHINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRQLDIEFMKHLSRVVNIIPVIAKSDTLTPEEKTEFKQRVRKELEVCGIECYPQKEFDEDMEDKSDNDKIRETMPFAVVGSDKEYQVNGKRVLGRKTAWGVVEVENPNHCEFSLLRDFMIRSHLQDLKEVTHNIHYETYRAKRLNDNGGLHPISSSGHDTQESNL.
For Research Use Only | Not For Clinical Use.
Online Inquiry