AibGenesis™ Mouse Anti-sgcB Antibody (CBMOAB-2585YC)
Cat: CBMOAB-2585YC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-2585YC | Monoclonal | E. coli (Escherichia coli ), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) | WB, ELISA | MO2585YC | 100 µg | ||
| CBMOAB-97935FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO97935FYA | 100 µg | ||
| MO-AB-07589H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07589C | 100 µg | ||
| MO-AB-09902Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09902Y | 100 µg | ||
| MO-AB-20059R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20059R | 100 µg | ||
| MO-AB-29076R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO29076R | 100 µg | ||
| MO-AB-33309W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33309W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | E. coli (Escherichia coli ), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) |
| Clone | MO2585YC |
| Specificity | This antibody binds to Escherichia coli K-12 sgcB. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-E. coli sgcB Antibody is a mouse antibody against sgcB. It can be used for sgcB detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Putative phosphotransferase enzyme IIB component SgcB; EC 2.7.1.69; Putative PTS system EIIB component; sgcB; b4565 JW5967 |
| UniProt ID | P58035 |
| Protein Refseq | The length of the protein is 92 amino acids long. The sequence is show below: MKKILVACGTGMSTSTMIAHKLQEFLTEQGISATTAQCCLNEIPLNCNGMDLIVTSMRTNSDYGIPTLNGAALLTGINDDALKQQIKALLTQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry