Mouse Anti-A. thaliana FAAH Antibody (CBMOAB-61864FYC)


Cat: CBMOAB-61864FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO61864FYC
SpecificityThis antibody binds to A. thaliana FAAH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFatty acid amide hydrolase or FAAH (oleamide hydrolase, anandamide amidohydrolase) is a member of the serine hydrolase family of enzymes. It was first shown to break down anandamide in 1993. In humans, it is encoded by the gene FAAH.
Product OverviewMouse Anti-A. thaliana FAAH Antibody is a mouse antibody against FAAH. It can be used for FAAH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFatty acid amide hydrolase; FAAH
UniProt IDA0A097PM28
Protein RefseqThe length of the protein is 516 amino acids long.
The sequence is show below: MKAPHLTGLSFKLFVNLLEAPLIGSLILKKDNKIFRNTVIPEEPMFRPEFPQEPEHDVVIVGEDESPIDRLETALKCLPQYDPFRYWKIRDYAYAYRSTPLQVAKRIISIIEEPPTPFLIRFDANEVIKQAEASTRRFEQGNPISVLDGIFVTIKDDIDCLPHPTNGGTTWLHEDRSVEKDSAVVSKLRSCGAILLGKANMHELGMGTTGNNSNYGTTRNPHDPKRYTGGSSSGSAAIVAAGLCSAALGTDGGGSVRIPSALCGITGLKTTYGRTDMTGSLCEGGTVEIIGPLASSLEDAFLVYAAILGSSSADRYNLKPFPKLLSIGSLRLGKYTKWFNDVSSSDISDKCEDILKLLEIVVPELEEMRAAHVISIGSPKLSYDTRTSFAIFRSFSASDYIAAQCLRRRLMEYHLNIFKDVDVIVTPTTGMTAPVIPPDALKNGETNIQVTTDLMRFVLAANLLGFPAISVPVGYDKEGLPIGLQIMGRPWAEATVLGLAAAVEELKKPAIFYDIL.
See other products for " FAAH "
MO-AB-25732RMouse Anti-Pig FAAH Antibody (MO-AB-25732R)
CBMOAB-42153FYAMouse Anti-Rhesus FAAH Antibody (CBMOAB-42153FYA)
MO-AB-12235RMouse Anti-Cattle FAAH Antibody (MO-AB-12235R)
MO-AB-03679WMouse Anti-Rhesus FAAH Antibody (MO-AB-03679W)
MO-DKB-0196RARabbit Anti-FAAH Antibody (MO-DKB-0196RA)
MO-AB-55214WMouse Anti-Marmoset FAAH Antibody (MO-AB-55214W)
CBMOAB-33100FYCMouse Anti-Arabidopsis FAAH Antibody (CBMOAB-33100FYC)
CBMOAB-75668FYAMouse Anti-Zebrafish FAAH Antibody (CBMOAB-75668FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry