Mouse Anti-Rhesus FAAH Antibody (MO-AB-03679W)
Cat: MO-AB-03679W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO03679W |
Specificity | This antibody binds to Rhesus FAAH. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein that is responsible for the hydrolysis of a number of primary and secondary fatty acid amides, including the neuromodulatory compounds anandamide and oleamide. |
Product Overview | Mouse Anti-Rhesus FAAH Antibody is a mouse antibody against FAAH. It can be used for FAAH detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Fatty Acid Amide Hydrolase; Anandamide Amidohydrolase 1; Oleamide Hydrolase 1; Fatty-Acid Amide Hydrolase 1; EC 3.5.1.n2; EC 3.5.1.99 |
UniProt ID | F6Z424 |
Protein Refseq | The length of the protein is 77 amino acids long. The sequence is show below: MGDRILPFLAAVWLCQLAFCTDPLTTVREQCEQLEKCVKARERLELCDKRVSSRSRTEEDCTEELLDFLHARDHCVS. |
See other products for " FAAH "
CBMOAB-42153FYA | Mouse Anti-Rhesus FAAH Antibody (CBMOAB-42153FYA) |
MO-AB-25732R | Mouse Anti-Pig FAAH Antibody (MO-AB-25732R) |
CBMOAB-61864FYC | Mouse Anti-A. thaliana FAAH Antibody (CBMOAB-61864FYC) |
MO-DKB-0196RA | Rabbit Anti-FAAH Antibody (MO-DKB-0196RA) |
MO-AB-55214W | Mouse Anti-Marmoset FAAH Antibody (MO-AB-55214W) |
MO-AB-12235R | Mouse Anti-Cattle FAAH Antibody (MO-AB-12235R) |
CBMOAB-33100FYC | Mouse Anti-Arabidopsis FAAH Antibody (CBMOAB-33100FYC) |
CBMOAB-75668FYA | Mouse Anti-Zebrafish FAAH Antibody (CBMOAB-75668FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry