Mouse Anti-A2M Antibody (MO-AB-06722R)


Cat: MO-AB-06722R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06722R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit WB, ELISA MO06722R 100 µg
MO-AB-17838W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17838W 100 µg
MO-AB-50149W Monoclonal Marmoset WB, ELISA MO50149W 100 µg
MO-AB-23433R Monoclonal Pig (Sus scrofa) WB, ELISA MO23433R 100 µg
MO-AB-01108H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01108C 100 µg
MOFY-0622-FY197 Polyclonal Rabbit WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit
CloneMO06722R
SpecificityThis antibody binds to Cattle A2M.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a protease inhibitor and cytokine transporter. It uses a bait-and-trap mechanism to inhibit a broad spectrum of proteases, including trypsin, thrombin and collagenase. It can also inhibit inflammatory cytokines, and it thus disrupts inflammatory cascades. Mutations in this gene are a cause of alpha-2-macroglobulin deficiency. This gene is implicated in Alzheimer's disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits. A related pseudogene, which is also located on the p arm of chromosome 12, has been identified. (From NCBI)
Product OverviewMouse Anti-Cattle A2M Antibody is a mouse antibody against A2M. It can be used for A2M detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlpha-2-macroglobulin; Alpha-2-M; A2M
UniProt IDQ7SIH1
Protein RefseqThe length of the protein is 1510 amino acids long.
The sequence is show below: MGKNKLLYPSLTLLLLLLLPTDASVSGKPQYMVLVPSLLHTETPEKGCLLLSHLNETVTVSASLESVRENRSLFTDVVAEKDLFHCVSFTLPRSPTSQEVMFLTIQVKGPTQEFKKRTTVLVKNEESLVFVQTDKPIYKPEQTVKFRIVLLDESFHPLNELVPLVYVEDPKGNRIAQWQNLEVENGLQQLTFPLSSEPFQGSYKVVVQKGSGGTAEHPFTVEEFVLPKFEVQVRMPKIITILEEEVQVSVCGLYT.
See other products for " A2M "
For Research Use Only | Not For Clinical Use.
Online Inquiry