Mouse Anti-ABCD2 Antibody (MO-AB-23448R)
Cat: MO-AB-23448R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-23448R | Monoclonal | Pig (Sus scrofa), Cattle (Bos taurus), Zebrafish (Danio rerio) | WB, ELISA | MO23448R | 100 µg | ||
| CBMOAB-64396FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO64396FYA | 100 µg | ||
| MO-AB-06759R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO06759R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Pig (Sus scrofa), Cattle (Bos taurus), Zebrafish (Danio rerio) |
| Clone | MO23448R |
| Specificity | This antibody binds to Pig ABCD2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Peroxisome; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown; however this protein is speculated to function as a dimerization partner of ABCD1 and/or other peroxisomal ABC transporters. Mutations in this gene have been observed in patients with adrenoleukodystrophy, a severe demyelinating disease. This gene has been identified as a candidate for a modifier gene, accounting for the extreme variation among adrenoleukodystrophy phenotypes. This gene is also a candidate for a complement group of Zellweger syndrome, a genetically heterogeneous disorder of peroxisomal biogenesis. |
| Product Overview | This product is a mouse antibody against ABCD2. It can be used for ABCD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ATP-binding cassette sub-family D member 2, Fragment; ABCD2 |
| UniProt ID | Q2LC38 |
| Protein Refseq | The length of the protein is 71 amino acids long. The sequence is show below: MIAIPATFVNSAIRYLEGKLALAFRTRLVDHAYETYFTNQTYYKVINMDGRLANPDQSLTEDIMMFSQSVA. |
See other products for " ABCD2 "
| CBMOAB-34839FYA | Mouse Anti-ABCD2 Antibody (CBMOAB-34839FYA) |
| MO-AB-50206W | Mouse Anti-ABCD2 Antibody (MO-AB-50206W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry