Mouse Anti-ABCD2 Antibody (MO-AB-23448R)


Cat: MO-AB-23448R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-23448R Monoclonal Pig (Sus scrofa), Cattle (Bos taurus), Zebrafish (Danio rerio) WB, ELISA MO23448R 100 µg
CBMOAB-64396FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64396FYA 100 µg
MO-AB-06759R Monoclonal Cattle (Bos taurus) WB, ELISA MO06759R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), Cattle (Bos taurus), Zebrafish (Danio rerio)
CloneMO23448R
SpecificityThis antibody binds to Pig ABCD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown; however this protein is speculated to function as a dimerization partner of ABCD1 and/or other peroxisomal ABC transporters. Mutations in this gene have been observed in patients with adrenoleukodystrophy, a severe demyelinating disease. This gene has been identified as a candidate for a modifier gene, accounting for the extreme variation among adrenoleukodystrophy phenotypes. This gene is also a candidate for a complement group of Zellweger syndrome, a genetically heterogeneous disorder of peroxisomal biogenesis. (From NCBI)
Product OverviewThis product is a mouse antibody against ABCD2. It can be used for ABCD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-binding cassette sub-family D member 2, Fragment; ABCD2
UniProt IDQ2LC38
Protein RefseqThe length of the protein is 71 amino acids long.
The sequence is show below: MIAIPATFVNSAIRYLEGKLALAFRTRLVDHAYETYFTNQTYYKVINMDGRLANPDQSLTEDIMMFSQSVA.
For Research Use Only | Not For Clinical Use.
Online Inquiry