AibGenesis™ Mouse Anti-abhd17b Antibody (CBMOAB-64457FYA)


Cat: CBMOAB-64457FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-64457FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus) WB, ELISA MO64457FYA 100 µg
MO-AB-06797R Monoclonal Cattle (Bos taurus) WB, ELISA MO06797R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus)
CloneMO64457FYA
SpecificityThis antibody binds to Zebrafish abhd17b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish abhd17b Antibody is a mouse antibody against abhd17b. It can be used for abhd17b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesabhd17b; XP_005171891.1
UniProt IDA3KPQ6
Protein RefseqThe length of the protein is 288 amino acids long.
The sequence is show below: MNHLSLSELCCLFCCPPCPSRIASKLAFLPPEPTYTLMCDESGSRWTLHLSERADWQYTAREKDAIECFMTRTSRGNRIACMFVRCSPNARYTLLFSHGNAVDLGQMSSFYIGLGSRINCNVFSYDYSGYGASSGKPSEKNLYADVDAAWHALRTRYGIRPENVIIYGQSIGTVPSVDLASRYESAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIDKISKVTSPVLVIHGTEDEVIDFSHGLALYERCQRPVEPLWVEGAGHNDVELYGQYLERLKQFVAHELVNL.
For Research Use Only | Not For Clinical Use.
Online Inquiry