AibGenesis™ Mouse Anti-acbd7 Antibody (CBMOAB-64615FYA)


Cat: CBMOAB-64615FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-64615FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO64615FYA 100 µg
MO-AB-06867R Monoclonal Cattle (Bos taurus) WB, ELISA MO06867R 100 µg
MO-AB-23956H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23956C 100 µg
MO-AB-50306W Monoclonal Marmoset WB, ELISA MO50306W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO64615FYA
SpecificityThis antibody binds to Zebrafish acbd7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish acbd7 Antibody is a mouse antibody against acbd7. It can be used for acbd7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcbd7 protein; acbd
UniProt IDQ4V8S5
Protein RefseqThe length of the protein is 88 amino acids long.
The sequence is show below: MTLKAEFDQYAEDVKKVKTRPTDQELLDLYGLYKQAVVGDINIDKPGMIDLKGKAKWDAWDSRKGMSTEDAMKAYITLAKQAIEKYGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry