AibGenesis™ Mouse Anti-accD Antibody (CBMOAB-18469FYB)


Cat: CBMOAB-18469FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18469FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), French-bean WB, ELISA MO18469FYB 100 µg
CBMOAB-1424FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO1424FC 100 µg
MO-AB-00004W Monoclonal Barrel medic (Medicago truncatula) WB, ELISA MO00004W 100 µg
MO-AB-36046W Monoclonal French-bean WB, ELISA MO36046W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), French-bean
CloneMO18469FYB
SpecificityThis antibody binds to Rice accD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice accD Antibody is a mouse antibody against accD. It can be used for accD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative acetyl-coenzyme A carboxylase carboxyl transferase subunit beta-like protein; accD; ycf11
UniProt IDP0C2Y4
Protein RefseqThe length of the protein is 106 amino acids long.
The sequence is show below: MALQSLRGSMRSVVGKRICPLIEYAIFPPLPRIIVYASRRARMQRGNYSLIKKPKKVSTLRQYQSTKSPMYQSLQRICGVREWLNKYCMWKEVDEKDFGFEIGAFD.
For Research Use Only | Not For Clinical Use.
Online Inquiry