AibGenesis™ Mouse Anti-actr1a Antibody (MO-AB-01211H)


Cat: MO-AB-01211H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-01211H Monoclonal Frog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Guinea pig (Cavia porcellus), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio), Rhesus (Macaca mulatta), Marmoset WB, ELISA MO01211C 100 µg
Inquiry
MO-AB-06957R Monoclonal Cattle (Bos taurus) WB, ELISA MO06957R 100 µg
Inquiry
MO-AB-16868W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16868W 100 µg
Inquiry
MO-AB-28809W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28809W 100 µg
Inquiry
MO-AB-43575W Monoclonal Horse (Equus caballus) WB, ELISA MO43575W 100 µg
Inquiry
MO-AB-50393W Monoclonal Marmoset WB, ELISA MO50393W 100 µg
Inquiry
MO-DKB-01137W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg
Inquiry
MO-DKB-03500W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcellus), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Guinea pig (Cavia porcellus), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio), Rhesus (Macaca mulatta), Marmoset
CloneMO01211C
SpecificityThis antibody binds to Frog actr1a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. (From NCBI)
Product OverviewThis product is a mouse antibody against actr1a. It can be used for actr1a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActr1a-prov protein; actr1a; actr1a-prov
UniProt IDQ6DJH8
Protein RefseqThe length of the protein is 376 amino acids long.
The sequence is show below: MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHIRVMAGALEGDLFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHTSAEFEIVKTIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPARFRAPELLFRPDLIGEECEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARAIHRKTF.
For Research Use Only | Not For Clinical Use.
Online Inquiry