Mouse Anti-ADA2 Antibody (CBMOAB-18486FYB)


Cat: CBMOAB-18486FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18486FYB Monoclonal Rice (Oryza), C. elegans (Caenorhabditis elegans), Frog (Xenopus laevis), Maize (Zea mays), Rhesus (Macaca mulatta) WB, ELISA MO18486FYB 100 µg
CBMOAB-00371HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO00371HB 100 µg
MO-AB-00937W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO00937W 100 µg
MO-AB-47204W Monoclonal Maize (Zea mays) WB, ELISA MO47204W 100 µg
MO-AB-01223H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01223C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), C. elegans (Caenorhabditis elegans), Frog (Xenopus laevis), Maize (Zea mays), Rhesus (Macaca mulatta)
CloneMO18486FYB
SpecificityThis antibody binds to Rice ADA2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein is one of two adenosine deaminases found in humans, which regulate levels of the signaling molecule, adenosine. The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rice ADA2 Antibody is a mouse antibody against ADA2. It can be used for ADA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscriptional adapter ADA2; ADA2; Os03g0750800 LOC_Os03g53960
UniProt IDQ75LL6
Protein RefseqThe length of the protein is 567 amino acids long.
The sequence is show below: MGRSRGVPNSGDDETNHRSKRRRVASSGDAPDSLSAACGGAGEGGGKKALYHCNYCNKDISGKIRIKCSKCPDFDLCVECFSVGAEVTPHRSNHPYRVMDNLSFPLICPDWNADEEILLLEGIEMYGLGNWAEVAEHVGTKTKAQCIDHYTTAYMNSPCYPLPDMSHVNGKNRKELLAMAKVQGESKKVLPGDLTPKDESPFSPPRVKVEDALGEGLAGRSPSHIAGGANKKASNVGQFKDGANVAKVEDGHVDRSIGVKKPRYSADEGPSLTELSGYNSKRHEFDPEYDNDAEQALAEMEFKETDSETDRELKLRVLRIYLSRLDERKRRKEFILERNLLFPNPLEKDLTNEDKEVYHRYKVFMRFLSKEEHEALVRSVLEERKIRRRIQELQECRSAGCRTLAEAKIHIEQKRKKEHEVNAQKAKESGQLLSNTKVVHKTNRPMKIESDGNLDQKKGGASLDSTGRDSPKTTGHAGTKHWDDWDIVGFPGAELLSTSEKNLCCQNRLLPNHYLKMQEVLMQEIFKGSVAKKEDAHVLFKVDPAKVDNVYDMVTKKLGTNEEAPTV.
See other products for " ADA2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry