AibGenesis™ Mouse Anti-ADIRF Antibody (MO-AB-07057R)


Cat: MO-AB-07057R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07057R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO07057R 100 µg
MO-AB-13649W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13649W 100 µg
MO-AB-50502W Monoclonal Marmoset WB, ELISA MO50502W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO07057R
SpecificityThis antibody binds to Cattle ADIRF.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle ADIRF Antibody is a mouse antibody against ADIRF. It can be used for ADIRF detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChromosome 10 open reading frame 116 ortholog; C28H10ORF116; C28H10orf116
UniProt IDQ2NKR5
Protein RefseqThe length of the protein is 76 amino acids long.
The sequence is show below: MASKGLQDLKKQVEGAAQEAVTSAGTAVQQVVDQATEAGQKAMDQVAKTTQETIDQTANQASETFSGFGKKLGLLK.
For Research Use Only | Not For Clinical Use.
Online Inquiry