AibGenesis™ Mouse Anti-ADIRF Antibody (MO-AB-07057R)
Cat: MO-AB-07057R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-07057R | Monoclonal | Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset | WB, ELISA | MO07057R | 100 µg | ||
| MO-AB-13649W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13649W | 100 µg | ||
| MO-AB-50502W | Monoclonal | Marmoset | WB, ELISA | MO50502W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset |
| Clone | MO07057R |
| Specificity | This antibody binds to Cattle ADIRF. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Cattle ADIRF Antibody is a mouse antibody against ADIRF. It can be used for ADIRF detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Chromosome 10 open reading frame 116 ortholog; C28H10ORF116; C28H10orf116 |
| UniProt ID | Q2NKR5 |
| Protein Refseq | The length of the protein is 76 amino acids long. The sequence is show below: MASKGLQDLKKQVEGAAQEAVTSAGTAVQQVVDQATEAGQKAMDQVAKTTQETIDQTANQASETFSGFGKKLGLLK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry