AibGenesis™ Mouse Anti-AIM1L Antibody (CBMOAB-35389FYA)


Cat: CBMOAB-35389FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35389FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO35389FYA 100 µg
MO-AB-07167R Monoclonal Cattle (Bos taurus) WB, ELISA MO07167R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO35389FYA
SpecificityThis antibody binds to Rhesus AIM1L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus AIM1L Antibody is a mouse antibody against AIM1L. It can be used for AIM1L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAIM1L
UniProt IDF6QMR1
Protein RefseqThe length of the protein is 616 amino acids long.
The sequence is show below: MELRTPETKWSPQGIGSLRRVVWDYRTPEISLFSEEGLKGAQVKLREALKNSQGLEKPLQVASATVSAGLWLLYPKPLFEDTPYILEPGEYPTSEAWGTSDPSVGSLKPMRLGCPSVEKPGEPRAVVYEAPGFQGCSWEVSQDIYNLQQPEDSQSPHLASVGSLRVLGGCWVGYEKEGFRGHQYLLEEGEYPDWSHWGGYDELLTSLRVIRTDFGDPAIVLFEAMDFEGHGVEVSKALPDVELVQHGPSTQAIHVLSGVWVAYQEVGFSGEQYVLEKGVYRNCEDWGAGNSALASLQPVLQVGEHDLHFVSKIQLFSRPDFLGDHFSFEDDQAALPASFRPQSCRVHGGSWILFDEKNFKGDQHILSEGEFPTLTAMGCLASTVLGSLQKVSLHFSEPSIFLYGLQCFEGKEIELSREVRSLQAEGFNNHVLSVRIKGGVWVLCEHSDFRGRQWLVGSCEITNWLTYSGIQRVGSLYPIKQRRVYFRLWNAALGGFLAVPDHVEDMKAGRVVVSDPRAGGSCIWYYEDGLLKNQMAPTMSLQVIGPPSPGSKVVLWAESRLPRQTWSISESGHICSQMFEGQILDVKGGRGYDRDHVVLWEPDEDRASQIWTIHVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry