Mouse Anti-AK4 Antibody (CBMOAB-1982FYC)
Cat: CBMOAB-1982FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-1982FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO1982FC | 100 µg | ||
CBMOAB-35399FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO35399FYA | 100 µg | ||
CBMOAB-65347FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65347FYA | 100 µg | ||
MO-AB-08077W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08077W | 100 µg | ||
MO-AB-13654W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13654W | 100 µg | ||
MO-AB-34357W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34357W | 100 µg | ||
MO-AB-38437W | Monoclonal | Gorilla | WB, ELISA | MO38437W | 100 µg | ||
MO-AB-43617W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43617W | 100 µg | ||
MO-AB-50641W | Monoclonal | Marmoset | WB, ELISA | MO50641W | 100 µg | ||
MO-AB-24016H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24016C | 100 µg | ||
MO-AB-32818H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32818C | 100 µg | ||
MO-AB-00029L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00029L | 100 µg | ||
MO-AB-00098Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00098Y | 100 µg | ||
MO-AB-07134Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07134Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO1982FC |
Specificity | This antibody binds to Arabidopsis AK4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1. |
Product Overview | Mouse Anti-Arabidopsis AK4 Antibody is a mouse antibody against AK4. It can be used for AK4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adenylate Kinase 4; Adenylate Kinase 3-Like 1; AK3L1; AK 4; AK3; GTP:AMP Phosphotransferase AK4, Mitochondrial; Adenylate Kinase Isoenzyme 4, Mitochondrial; Nucleoside-Triphosphate-Adenylate Kinase; Adenylate Kinase 4, Mitochondrial; Mitochondrial Adenylate Kinase-3 |
UniProt ID | Q38991 |
Protein Refseq | The length of the protein is 57 amino acids long. The sequence is show below: KASNILLDADMNPKIADFGMARIFGVDQTVANTARVVGTFGYMSPEYVTHGQFSMKS. |
See other products for " ak4 "
MO-AB-00037R | Mouse Anti-ak4 Antibody (MO-AB-00037R) |
MO-AB-07176R | Mouse Anti-AK4 Antibody (MO-AB-07176R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry